RAPH1,ALS2CR18
  • RAPH1,ALS2CR18

Anti-RAPH1 Antibody 100ul

Ref: AN-HPA016744-100ul
Anti-RAPH1

Información del producto

Polyclonal Antibody against Human RAPH1, Gene description: Ras association (RalGDS/AF-6) and pleckstrin homology domains 1, Alternative Gene Names: ALS2CR18, ALS2CR9, KIAA1681, Validated applications: IHC, WB, Uniprot ID: Q70E73, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RAPH1
Gene Description Ras association (RalGDS/AF-6) and pleckstrin homology domains 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence QLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDSDKPMEPVKRSPLRQETNMANFSYRFSIYNLN
Immunogen QLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDSDKPMEPVKRSPLRQETNMANFSYRFSIYNLN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ALS2CR18, ALS2CR9, KIAA1681
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q70E73
HTS Code 3002150000
Gene ID 65059
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RAPH1 Antibody 100ul

Anti-RAPH1 Antibody 100ul