CBX5,HP1,HP1-ALPHA
  • CBX5,HP1,HP1-ALPHA

Anti-CBX5 Antibody 25ul

Ref: AN-HPA016699-25ul
Anti-CBX5

Información del producto

Polyclonal Antibody against Human CBX5, Gene description: chromobox homolog 5, Alternative Gene Names: HP1, HP1-ALPHA, HP1Hs-alpha, Validated applications: ICC, IHC, WB, Uniprot ID: P45973, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CBX5
Gene Description chromobox homolog 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence VVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLM
Immunogen VVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HP1, HP1-ALPHA, HP1Hs-alpha
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P45973
HTS Code 3002150000
Gene ID 23468
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CBX5 Antibody 25ul

Anti-CBX5 Antibody 25ul