TEX261,MGC32043
  • TEX261,MGC32043

Anti-TEX261 Antibody 100ul

Ref: AN-HPA016631-100ul
Anti-TEX261

Información del producto

Polyclonal Antibody against Human TEX261, Gene description: testis expressed 261, Alternative Gene Names: MGC32043, TEG-261, Validated applications: ICC, IHC, WB, Uniprot ID: Q6UWH6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TEX261
Gene Description testis expressed 261
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications IHC, WB, ICC
Sequence NVLPSTMQPGDDVVSNYFTKGKRGKRLGILVVFSFIKEAILPSRQKIY
Immunogen NVLPSTMQPGDDVVSNYFTKGKRGKRLGILVVFSFIKEAILPSRQKIY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC32043, TEG-261
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6UWH6
HTS Code 3002150000
Gene ID 113419
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TEX261 Antibody 100ul

Anti-TEX261 Antibody 100ul