TRIP4,HsT17391
  • TRIP4,HsT17391

Anti-TRIP4 Antibody 25ul

Ref: AN-HPA016605-25ul
Anti-TRIP4

Información del producto

Polyclonal Antibody against Human TRIP4, Gene description: thyroid hormone receptor interactor 4, Alternative Gene Names: HsT17391, ZC2HC5, Validated applications: IHC, WB, Uniprot ID: Q15650, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TRIP4
Gene Description thyroid hormone receptor interactor 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence ILQRDSNKSQKLLKKLMSGVENSGKVDISTKDLLPHQELRIKSGLEKAIKHKDKLLEFDRTSIRRTQVIDDESDYFASDSNQWLSKLERETLQKREEELRELRHASRLSKKVTIDFAGRKILEEENSLA
Immunogen ILQRDSNKSQKLLKKLMSGVENSGKVDISTKDLLPHQELRIKSGLEKAIKHKDKLLEFDRTSIRRTQVIDDESDYFASDSNQWLSKLERETLQKREEELRELRHASRLSKKVTIDFAGRKILEEENSLA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HsT17391, ZC2HC5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15650
HTS Code 3002150000
Gene ID 9325
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TRIP4 Antibody 25ul

Anti-TRIP4 Antibody 25ul