DERL1,DER-1,DER1
  • DERL1,DER-1,DER1

Anti-DERL1 Antibody 100ul

Ref: AN-HPA016562-100ul
Anti-DERL1

Información del producto

Polyclonal Antibody against Human DERL1, Gene description: derlin 1, Alternative Gene Names: DER-1, DER1, derlin-1, FLJ13784, MGC3067, PRO2577, Validated applications: ICC, IHC, WB, Uniprot ID: Q9BUN8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DERL1
Gene Description derlin 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC, IHC
Sequence LMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ
Immunogen LMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DER-1, DER1, derlin-1, FLJ13784, MGC3067, PRO2577
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BUN8
HTS Code 3002150000
Gene ID 79139
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DERL1 Antibody 100ul

Anti-DERL1 Antibody 100ul