ARID1B,6A3-5
  • ARID1B,6A3-5

Anti-ARID1B Antibody 25ul

Ref: AN-HPA016511-25ul
Anti-ARID1B

Información del producto

Polyclonal Antibody against Human ARID1B, Gene description: AT rich interactive domain 1B (SWI1-like), Alternative Gene Names: 6A3-5, BAF250b, DAN15, ELD/OSA1, KIAA1235, p250R, Validated applications: ICC, IHC, Uniprot ID: Q8NFD5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ARID1B
Gene Description AT rich interactive domain 1B (SWI1-like)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence SQYGPQGNYSRPPAYSGVPSASYSGPGPGMGISANNQMHGQGPSQPCGAVPLGRMPSAGMQNRPFPGNMSSMTPSSPGMSQQGGPGMGPPMPTVNRKAQEAAAAVMQAAANSAQSR
Immunogen SQYGPQGNYSRPPAYSGVPSASYSGPGPGMGISANNQMHGQGPSQPCGAVPLGRMPSAGMQNRPFPGNMSSMTPSSPGMSQQGGPGMGPPMPTVNRKAQEAAAAVMQAAANSAQSR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 6A3-5, BAF250b, DAN15, ELD/OSA1, KIAA1235, p250R
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NFD5
HTS Code 3002150000
Gene ID 57492
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ARID1B Antibody 25ul

Anti-ARID1B Antibody 25ul