EVC,DWF-1
  • EVC,DWF-1

Anti-EVC Antibody 25ul

Ref: AN-HPA016046-25ul
Anti-EVC

Información del producto

Polyclonal Antibody against Human EVC, Gene description: Ellis van Creveld syndrome, Alternative Gene Names: DWF-1, Validated applications: ICC, IHC, Uniprot ID: P57679, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EVC
Gene Description Ellis van Creveld syndrome
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence ETGSPSRRRKREVQMSKDKEAVDECEPPSNSNITAFALKAKVIYPINQKFRPLADGSSNPSLHENLKQAVLPHQPVEASPSSSLGSLSQGEKDDCSSSSSVHS
Immunogen ETGSPSRRRKREVQMSKDKEAVDECEPPSNSNITAFALKAKVIYPINQKFRPLADGSSNPSLHENLKQAVLPHQPVEASPSSSLGSLSQGEKDDCSSSSSVHS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DWF-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P57679
HTS Code 3002150000
Gene ID 2121
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EVC Antibody 25ul

Anti-EVC Antibody 25ul