TSPAN3,TM4-A,TM4SF8
  • TSPAN3,TM4-A,TM4SF8

Anti-TSPAN3 Antibody 100ul

Ref: AN-HPA015996-100ul
Anti-TSPAN3

Información del producto

Polyclonal Antibody against Human TSPAN3, Gene description: tetraspanin 3, Alternative Gene Names: TM4-A, TM4SF8, TSPAN-3, Validated applications: ICC, IHC, Uniprot ID: O60637, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TSPAN3
Gene Description tetraspanin 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence NGTNPDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNGSLAHPSDLYAEGCEALVVKKLQEI
Immunogen NGTNPDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNGSLAHPSDLYAEGCEALVVKKLQEI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names TM4-A, TM4SF8, TSPAN-3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60637
HTS Code 3002150000
Gene ID 10099
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TSPAN3 Antibody 100ul

Anti-TSPAN3 Antibody 100ul