CISD2,ERIS,Miner1
  • CISD2,ERIS,Miner1

Anti-CISD2 Antibody 100ul

Ref: AN-HPA015914-100ul
Anti-CISD2

Información del producto

Polyclonal Antibody against Human CISD2, Gene description: CDGSH iron sulfur domain 2, Alternative Gene Names: ERIS, Miner1, NAF-1, WFS2, ZCD2, Validated applications: ICC, IHC, WB, Uniprot ID: Q8N5K1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CISD2
Gene Description CDGSH iron sulfur domain 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV
Immunogen PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ERIS, Miner1, NAF-1, WFS2, ZCD2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N5K1
HTS Code 3002150000
Gene ID 493856
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CISD2 Antibody 100ul

Anti-CISD2 Antibody 100ul