TP53RK,BUD32
  • TP53RK,BUD32

Anti-TP53RK Antibody 100ul

Ref: AN-HPA015837-100ul
Anti-TP53RK

Información del producto

Polyclonal Antibody against Human TP53RK, Gene description: TP53 regulating kinase, Alternative Gene Names: BUD32, C20orf64, dJ101A2.2, Nori-2p, prpk, Validated applications: IHC, WB, Uniprot ID: Q96S44, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TP53RK
Gene Description TP53 regulating kinase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence AAVIKHRFPKGYRHPALEARLGRRRTVQEARALLRCRRAGISAPVVFFVDYASNCLYMEEIEGSVTVRDYIQSTMETEKTPQGLSNLAKTIGQV
Immunogen AAVIKHRFPKGYRHPALEARLGRRRTVQEARALLRCRRAGISAPVVFFVDYASNCLYMEEIEGSVTVRDYIQSTMETEKTPQGLSNLAKTIGQV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BUD32, C20orf64, dJ101A2.2, Nori-2p, prpk
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96S44
HTS Code 3002150000
Gene ID 112858
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TP53RK Antibody 100ul

Anti-TP53RK Antibody 100ul