DEFA5,DEF5,HD-5
  • DEFA5,DEF5,HD-5

Anti-DEFA5 Antibody 100ul

Ref: AN-HPA015775-100ul
Anti-DEFA5

Información del producto

Polyclonal Antibody against Human DEFA5, Gene description: defensin, alpha 5, Paneth cell-specific, Alternative Gene Names: DEF5, HD-5, Validated applications: IHC, WB, Uniprot ID: Q01523, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DEFA5
Gene Description defensin, alpha 5, Paneth cell-specific
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR
Immunogen ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DEF5, HD-5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q01523
HTS Code 3002150000
Gene ID 1670
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DEFA5 Antibody 100ul

Anti-DEFA5 Antibody 100ul