BNIP3L,BNIP3a,Nix
  • BNIP3L,BNIP3a,Nix

Anti-BNIP3L Antibody 100ul

Ref: AN-HPA015652-100ul
Anti-BNIP3L

Información del producto

Polyclonal Antibody against Human BNIP3L, Gene description: BCL2/adenovirus E1B 19kDa interacting protein 3-like, Alternative Gene Names: BNIP3a, Nix, Validated applications: ICC, IHC, Uniprot ID: O60238, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name BNIP3L
Gene Description BCL2/adenovirus E1B 19kDa interacting protein 3-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence SNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMK
Immunogen SNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BNIP3a, Nix
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60238
HTS Code 3002150000
Gene ID 665
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-BNIP3L Antibody 100ul

Anti-BNIP3L Antibody 100ul