HSPA12B,C20orf60
  • HSPA12B,C20orf60

Anti-HSPA12B Antibody 100ul

Ref: AN-HPA015639-100ul
Anti-HSPA12B

Información del producto

Polyclonal Antibody against Human HSPA12B, Gene description: heat shock 70kD protein 12B, Alternative Gene Names: C20orf60, dJ1009E24.2, Validated applications: IHC, Uniprot ID: Q96MM6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HSPA12B
Gene Description heat shock 70kD protein 12B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LAVPEMGLQGLYIGSSPERSPVPSPPGSPRTQESCGIAPLTPSQSPKPEVRAPQQASFSVVVAIDFGTTSSGYAFSFASDPEAIHMMRKWEGG
Immunogen LAVPEMGLQGLYIGSSPERSPVPSPPGSPRTQESCGIAPLTPSQSPKPEVRAPQQASFSVVVAIDFGTTSSGYAFSFASDPEAIHMMRKWEGG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf60, dJ1009E24.2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96MM6
HTS Code 3002150000
Gene ID 116835
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HSPA12B Antibody 100ul

Anti-HSPA12B Antibody 100ul