GAP43,B-50,PP46
  • GAP43,B-50,PP46

Anti-GAP43 Antibody 25ul

Ref: AN-HPA015600-25ul
Anti-GAP43

Información del producto

Polyclonal Antibody against Human GAP43, Gene description: growth associated protein 43, Alternative Gene Names: B-50, PP46, Validated applications: ICC, IHC, Uniprot ID: P17677, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GAP43
Gene Description growth associated protein 43
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence SFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKA
Immunogen SFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names B-50, PP46
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P17677
HTS Code 3002150000
Gene ID 2596
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GAP43 Antibody 25ul

Anti-GAP43 Antibody 25ul