NEUROD4,ATH-3,Atoh3
  • NEUROD4,ATH-3,Atoh3

Anti-NEUROD4 Antibody 100ul

Ref: AN-HPA015545-100ul
Anti-NEUROD4

Información del producto

Polyclonal Antibody against Human NEUROD4, Gene description: neuronal differentiation 4, Alternative Gene Names: ATH-3, Atoh3, bHLHa4, MATH-3, Validated applications: IHC, Uniprot ID: Q9HD90, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NEUROD4
Gene Description neuronal differentiation 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VLLEKHEDKSPICDSAISVHNFNYQSPGLPSPPYGHMETHLLHLKPQVFKSLGESSFGSHLPDCSTPPYEGPLTPPLSISGNFSLKQDGSPDLEKSYSFMPHYPSSSLSSGHVHSTPFQAGTPRYDVPIDMSYDSYPHHGIGTQLNTVFT
Immunogen VLLEKHEDKSPICDSAISVHNFNYQSPGLPSPPYGHMETHLLHLKPQVFKSLGESSFGSHLPDCSTPPYEGPLTPPLSISGNFSLKQDGSPDLEKSYSFMPHYPSSSLSSGHVHSTPFQAGTPRYDVPIDMSYDSYPHHGIGTQLNTVFT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ATH-3, Atoh3, bHLHa4, MATH-3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HD90
HTS Code 3002150000
Gene ID 58158
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NEUROD4 Antibody 100ul

Anti-NEUROD4 Antibody 100ul