ARL6IP5,DERP11
  • ARL6IP5,DERP11

Anti-ARL6IP5 Antibody 100ul

Ref: AN-HPA015540-100ul
Anti-ARL6IP5

Información del producto

Polyclonal Antibody against Human ARL6IP5, Gene description: ADP-ribosylation factor-like 6 interacting protein 5, Alternative Gene Names: DERP11, GTRAP3-18, HSPC127, JWA, PRAF3, Validated applications: ICC, IHC, WB, Uniprot ID: O75915, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ARL6IP5
Gene Description ADP-ribosylation factor-like 6 interacting protein 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence PLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE
Immunogen PLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DERP11, GTRAP3-18, HSPC127, JWA, PRAF3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75915
HTS Code 3002150000
Gene ID 10550
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ARL6IP5 Antibody 100ul

Anti-ARL6IP5 Antibody 100ul