ENTPD6,CD39L2
  • ENTPD6,CD39L2

Anti-ENTPD6 Antibody 25ul

Ref: AN-HPA015491-25ul
Anti-ENTPD6

Información del producto

Polyclonal Antibody against Human ENTPD6, Gene description: ectonucleoside triphosphate diphosphohydrolase 6 (putative), Alternative Gene Names: CD39L2, dJ738P15.3, IL6ST2, NTPDase-6, Validated applications: ICC, Uniprot ID: O75354, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ENTPD6
Gene Description ectonucleoside triphosphate diphosphohydrolase 6 (putative)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence FFSITRAAPGARWGQQAHSPLGTAADGHEVFYGIMFDAGSTGTRVHVFQFTRPPRETPTLTHETFKALKPGLSAYADDVEKSAQGIRELLDVAKQDIPFDFWKATPLVLK
Immunogen FFSITRAAPGARWGQQAHSPLGTAADGHEVFYGIMFDAGSTGTRVHVFQFTRPPRETPTLTHETFKALKPGLSAYADDVEKSAQGIRELLDVAKQDIPFDFWKATPLVLK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD39L2, dJ738P15.3, IL6ST2, NTPDase-6
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75354
HTS Code 3002150000
Gene ID 955
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ENTPD6 Antibody 25ul

Anti-ENTPD6 Antibody 25ul