ZBTB11,ZNF-U69274
  • ZBTB11,ZNF-U69274

Anti-ZBTB11 Antibody 25ul

Ref: AN-HPA015328-25ul
Anti-ZBTB11

Información del producto

Polyclonal Antibody against Human ZBTB11, Gene description: zinc finger and BTB domain containing 11, Alternative Gene Names: ZNF-U69274, ZNF913, Validated applications: ICC, IHC, WB, Uniprot ID: O95625, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZBTB11
Gene Description zinc finger and BTB domain containing 11
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence KKGEVQTVASTQDLRVQNGGTAPPVASSEGTTTSLPTELGDCEIVLLVNGELPEAEQNGEVGRQPEPQVSSEAESALSSVGCIADSHPEMESVDLITKNNQTELETSNNRENNTVSNIHPKLS
Immunogen KKGEVQTVASTQDLRVQNGGTAPPVASSEGTTTSLPTELGDCEIVLLVNGELPEAEQNGEVGRQPEPQVSSEAESALSSVGCIADSHPEMESVDLITKNNQTELETSNNRENNTVSNIHPKLS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ZNF-U69274, ZNF913
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95625
HTS Code 3002150000
Gene ID 27107
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZBTB11 Antibody 25ul

Anti-ZBTB11 Antibody 25ul