FCGRT,alpha-chain
  • FCGRT,alpha-chain

Anti-FCGRT Antibody 25ul

Ref: AN-HPA015130-25ul
Anti-FCGRT

Información del producto

Polyclonal Antibody against Human FCGRT, Gene description: Fc fragment of IgG, receptor, transporter, alpha, Alternative Gene Names: alpha-chain, FCRN, Validated applications: IHC, Uniprot ID: P55899, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FCGRT
Gene Description Fc fragment of IgG, receptor, transporter, alpha
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLK
Immunogen LSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names alpha-chain, FCRN
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P55899
HTS Code 3002150000
Gene ID 2217
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FCGRT Antibody 25ul

Anti-FCGRT Antibody 25ul