TMEM234,C1orf91
  • TMEM234,C1orf91

Anti-TMEM234 Antibody 100ul

Ref: AN-HPA015049-100ul
Anti-TMEM234

Información del producto

Polyclonal Antibody against Human TMEM234, Gene description: transmembrane protein 234, Alternative Gene Names: C1orf91, dJ622L5.7, FLJ90779, RP4-622L5, Validated applications: ICC, IHC, Uniprot ID: Q8WY98, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TMEM234
Gene Description transmembrane protein 234
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence DIGGKRKLDYCECGTQLCGSRHTCVSSFPEPISPEWVRTRPFPILPFPLQLFCF
Immunogen DIGGKRKLDYCECGTQLCGSRHTCVSSFPEPISPEWVRTRPFPILPFPLQLFCF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf91, dJ622L5.7, FLJ90779, RP4-622L5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WY98
HTS Code 3002150000
Gene ID 56063
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TMEM234 Antibody 100ul

Anti-TMEM234 Antibody 100ul