HACD3,B-ind1
  • HACD3,B-ind1

Anti-HACD3 Antibody 100ul

Ref: AN-HPA014837-100ul
Anti-HACD3

Información del producto

Polyclonal Antibody against Human HACD3, Gene description: 3-hydroxyacyl-CoA dehydratase 3, Alternative Gene Names: B-ind1, HSPC121, PTPLAD1, Validated applications: ICC, IHC, WB, Uniprot ID: Q9P035, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HACD3
Gene Description 3-hydroxyacyl-CoA dehydratase 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMELRAKEEERLNKLRLE
Immunogen MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMELRAKEEERLNKLRLE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names B-ind1, HSPC121, PTPLAD1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P035
HTS Code 3002150000
Gene ID 51495
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HACD3 Antibody 100ul

Anti-HACD3 Antibody 100ul