KCNH1,eag,eag1
  • KCNH1,eag,eag1

Anti-KCNH1 Antibody 25ul

Ref: AN-HPA014551-25ul
Anti-KCNH1

Información del producto

Polyclonal Antibody against Human KCNH1, Gene description: potassium channel, voltage gated eag related subfamily H, member 1, Alternative Gene Names: eag, eag1, h-eag, Kv10.1, Validated applications: ICC, Uniprot ID: O95259, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KCNH1
Gene Description potassium channel, voltage gated eag related subfamily H, member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence DSCDSGITKSDLRLDNVGEARSPQDRSPILAEVKHSFYPIPEQTLQATVLEVRHELKEDIKALNAKMTNIEKQLSEILRILTSRRSSQSPQELFEISRPQSPES
Immunogen DSCDSGITKSDLRLDNVGEARSPQDRSPILAEVKHSFYPIPEQTLQATVLEVRHELKEDIKALNAKMTNIEKQLSEILRILTSRRSSQSPQELFEISRPQSPES
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names eag, eag1, h-eag, Kv10.1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95259
HTS Code 3002150000
Gene ID 3756
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-KCNH1 Antibody 25ul

Anti-KCNH1 Antibody 25ul