CLCN2,ClC-2,CLC2
  • CLCN2,ClC-2,CLC2

Anti-CLCN2 Antibody 100ul

Ref: AN-HPA014545-100ul
Anti-CLCN2

Información del producto

Polyclonal Antibody against Human CLCN2, Gene description: chloride channel, voltage-sensitive 2, Alternative Gene Names: ClC-2, CLC2, EJM6, Validated applications: ICC, IHC, Uniprot ID: P51788, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CLCN2
Gene Description chloride channel, voltage-sensitive 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence GVDHAYVTSIGRLIGIVTLKELRKAIEGSVTAQGVKVRPPLASFRDSATSSSDTETTEVHALWGPHSRHG
Immunogen GVDHAYVTSIGRLIGIVTLKELRKAIEGSVTAQGVKVRPPLASFRDSATSSSDTETTEVHALWGPHSRHG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ClC-2, CLC2, EJM6
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P51788
HTS Code 3002150000
Gene ID 1181
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CLCN2 Antibody 100ul

Anti-CLCN2 Antibody 100ul