SDR42E1,HSPC105
  • SDR42E1,HSPC105

Anti-SDR42E1 Antibody 25ul

Ref: AN-HPA014388-25ul
Anti-SDR42E1

Información del producto

Polyclonal Antibody against Human SDR42E1, Gene description: short chain dehydrogenase/reductase family 42E, member 1, Alternative Gene Names: HSPC105, Validated applications: IHC, Uniprot ID: Q8WUS8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SDR42E1
Gene Description short chain dehydrogenase/reductase family 42E, member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence FQPFLTRTEVYKTGVTHYFSLEKAKKELGYKAQPFDLQEAVEWFKAHGHGRSSGSRDSEC
Immunogen FQPFLTRTEVYKTGVTHYFSLEKAKKELGYKAQPFDLQEAVEWFKAHGHGRSSGSRDSEC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HSPC105
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WUS8
HTS Code 3002150000
Gene ID 93517
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SDR42E1 Antibody 25ul

Anti-SDR42E1 Antibody 25ul