ENTPD7,FLJ30978
  • ENTPD7,FLJ30978

Anti-ENTPD7 Antibody 25ul

Ref: AN-HPA014351-25ul
Anti-ENTPD7

Información del producto

Polyclonal Antibody against Human ENTPD7, Gene description: ectonucleoside triphosphate diphosphohydrolase 7, Alternative Gene Names: FLJ30978, LALP1, Validated applications: IHC, Uniprot ID: Q9NQZ7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ENTPD7
Gene Description ectonucleoside triphosphate diphosphohydrolase 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence YEDLVLNETLNKNRLLGQKTGLSPDNPFLDPCLPVGLTDVVERNSQVLHVRGRGDWVSCGAMLSPLLARSNTSQASLNGIYQSPIDFNNSEF
Immunogen YEDLVLNETLNKNRLLGQKTGLSPDNPFLDPCLPVGLTDVVERNSQVLHVRGRGDWVSCGAMLSPLLARSNTSQASLNGIYQSPIDFNNSEF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ30978, LALP1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NQZ7
HTS Code 3002150000
Gene ID 57089
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ENTPD7 Antibody 25ul

Anti-ENTPD7 Antibody 25ul