MARCH4,KIAA1399
  • MARCH4,KIAA1399

Anti-MARCH4 Antibody 100ul

Ref: AN-HPA014348-100ul
Anti-MARCH4

Información del producto

Polyclonal Antibody against Human MARCH4, Gene description: membrane-associated ring finger (C3HC4) 4, E3 ubiquitin protein ligase, Alternative Gene Names: KIAA1399, MARCH-IV, RNF174, Validated applications: IHC, Uniprot ID: Q9P2E8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MARCH4
Gene Description membrane-associated ring finger (C3HC4) 4, E3 ubiquitin protein ligase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence WKVLNYDKTKDLEDQKAGGRTNPRTSSSTQANIPSSEEETAGTPAPEQGPAQAAGHPSGPLSHHHCAYTILHILSHLRPHEQRSP
Immunogen WKVLNYDKTKDLEDQKAGGRTNPRTSSSTQANIPSSEEETAGTPAPEQGPAQAAGHPSGPLSHHHCAYTILHILSHLRPHEQRSP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1399, MARCH-IV, RNF174
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P2E8
HTS Code 3002150000
Gene ID 57574
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MARCH4 Antibody 100ul

Anti-MARCH4 Antibody 100ul