KLK5,KLK-L2,SCTE
  • KLK5,KLK-L2,SCTE

Anti-KLK5 Antibody 100ul

Ref: AN-HPA014343-100ul
Anti-KLK5

Información del producto

Polyclonal Antibody against Human KLK5, Gene description: kallikrein-related peptidase 5, Alternative Gene Names: KLK-L2, SCTE, Validated applications: IHC, Uniprot ID: Q9Y337, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name KLK5
Gene Description kallikrein-related peptidase 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence CDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSH
Immunogen CDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KLK-L2, SCTE
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y337
HTS Code 3002150000
Gene ID 25818
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-KLK5 Antibody 100ul

Anti-KLK5 Antibody 100ul