CNN1,Sm-Calp,SMCC
  • CNN1,Sm-Calp,SMCC

Anti-CNN1 Antibody 25ul

Ref: AN-HPA014263-25ul
Anti-CNN1

Información del producto

Polyclonal Antibody against Human CNN1, Gene description: calponin 1, basic, smooth muscle, Alternative Gene Names: Sm-Calp, SMCC, Validated applications: IHC, WB, Uniprot ID: P51911, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CNN1
Gene Description calponin 1, basic, smooth muscle
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence PLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNS
Immunogen PLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Sm-Calp, SMCC
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P51911
HTS Code 3002150000
Gene ID 1264
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CNN1 Antibody 25ul

Anti-CNN1 Antibody 25ul