HLA-DQB1,CELIAC1
  • HLA-DQB1,CELIAC1

Anti-HLA-DQB1 Antibody 100ul

Ref: AN-HPA013667-100ul
Anti-HLA-DQB1

Información del producto

Polyclonal Antibody against Human HLA-DQB1, Gene description: major histocompatibility complex, class II, DQ beta 1, Alternative Gene Names: CELIAC1, HLA-DQB, IDDM1, Validated applications: IHC, WB, Uniprot ID: , Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HLA-DQB1
Gene Description major histocompatibility complex, class II, DQ beta 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence RPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRRVEPTVTISPSRTEALNHHNLLVCSVT
Immunogen RPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRRVEPTVTISPSRTEALNHHNLLVCSVT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CELIAC1, HLA-DQB, IDDM1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
HTS Code 3002150000
Gene ID 3119
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HLA-DQB1 Antibody 100ul

Anti-HLA-DQB1 Antibody 100ul