PDCD1LG2,B7-DC
  • PDCD1LG2,B7-DC

Anti-PDCD1LG2 Antibody 25ul

Ref: AN-HPA013411-25ul
Anti-PDCD1LG2

Información del producto

Polyclonal Antibody against Human PDCD1LG2, Gene description: programmed cell death 1 ligand 2, Alternative Gene Names: B7-DC, bA574F11.2, Btdc, CD273, PD-L2, PDL2, Validated applications: ICC, IHC, Uniprot ID: Q9BQ51, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PDCD1LG2
Gene Description programmed cell death 1 ligand 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence GYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPT
Immunogen GYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names B7-DC, bA574F11.2, Btdc, CD273, PD-L2, PDL2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BQ51
HTS Code 3002150000
Gene ID 80380
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PDCD1LG2 Antibody 25ul

Anti-PDCD1LG2 Antibody 25ul