SPCS2,KIAA0102
  • SPCS2,KIAA0102

Anti-SPCS2 Antibody 100ul

Ref: AN-HPA013386-100ul
Anti-SPCS2

Información del producto

Polyclonal Antibody against Human SPCS2, Gene description: signal peptidase complex subunit 2 homolog (S. cerevisiae), Alternative Gene Names: KIAA0102, Validated applications: ICC, IHC, WB, Uniprot ID: Q15005, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SPCS2
Gene Description signal peptidase complex subunit 2 homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence AAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLDDSAK
Immunogen AAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLDDSAK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0102
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15005
HTS Code 3002150000
Gene ID 9789
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SPCS2 Antibody 100ul

Anti-SPCS2 Antibody 100ul