ROBO2,KIAA1568
  • ROBO2,KIAA1568

Anti-ROBO2 Antibody 100ul

Ref: AN-HPA013371-100ul
Anti-ROBO2

Información del producto

Polyclonal Antibody against Human ROBO2, Gene description: roundabout, axon guidance receptor, homolog 2 (Drosophila), Alternative Gene Names: KIAA1568, Validated applications: IHC, Uniprot ID: Q9HCK4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ROBO2
Gene Description roundabout, axon guidance receptor, homolog 2 (Drosophila)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications IHC
Sequence PVNNSNSGPNEIGNFGRGDVLPPVPGQGDKTATMLSDGAIYSSIDFTTKTSYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSIQQKTDLMGFGYSLPDQNKGNNGGKGGKKKKNKNSSKPQKNNGSTWA
Immunogen PVNNSNSGPNEIGNFGRGDVLPPVPGQGDKTATMLSDGAIYSSIDFTTKTSYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSIQQKTDLMGFGYSLPDQNKGNNGGKGGKKKKNKNSSKPQKNNGSTWA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1568
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HCK4
HTS Code 3002150000
Gene ID 6092
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ROBO2 Antibody 100ul

Anti-ROBO2 Antibody 100ul