TNFAIP1,B12,B61
  • TNFAIP1,B12,B61

Anti-TNFAIP1 Antibody 100ul

Ref: AN-HPA013333-100ul
Anti-TNFAIP1

Información del producto

Polyclonal Antibody against Human TNFAIP1, Gene description: tumor necrosis factor, alpha-induced protein 1 (endothelial), Alternative Gene Names: B12, B61, BTBD34, EDP1, MGC2317, Validated applications: ICC, IHC, Uniprot ID: Q13829, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TNFAIP1
Gene Description tumor necrosis factor, alpha-induced protein 1 (endothelial)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence FGTILNYLRDDTITLPQNRQEIKELMAEAKYYLIQGLVNMCQSALQDKKDSYQPVCNIPIITSLKEEERLIESSTKPVVKLLYNRSNNKYS
Immunogen FGTILNYLRDDTITLPQNRQEIKELMAEAKYYLIQGLVNMCQSALQDKKDSYQPVCNIPIITSLKEEERLIESSTKPVVKLLYNRSNNKYS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names B12, B61, BTBD34, EDP1, MGC2317
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13829
HTS Code 3002150000
Gene ID 7126
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TNFAIP1 Antibody 100ul

Anti-TNFAIP1 Antibody 100ul