DCP1A,HSA275986
  • DCP1A,HSA275986

Anti-DCP1A Antibody 100ul

Ref: AN-HPA013202-100ul
Anti-DCP1A

Información del producto

Polyclonal Antibody against Human DCP1A, Gene description: decapping mRNA 1A, Alternative Gene Names: HSA275986, SMAD4IP1, SMIF, Validated applications: ICC, IHC, WB, Uniprot ID: Q9NPI6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DCP1A
Gene Description decapping mRNA 1A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence RSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVASFSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSASA
Immunogen RSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVASFSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSASA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HSA275986, SMAD4IP1, SMIF
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NPI6
HTS Code 3002150000
Gene ID 55802
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DCP1A Antibody 100ul

Anti-DCP1A Antibody 100ul