XCR1,CCXCR1,GPR5
  • XCR1,CCXCR1,GPR5

Anti-XCR1 Antibody 100ul

Ref: AN-HPA013169-100ul
Anti-XCR1

Información del producto

Polyclonal Antibody against Human XCR1, Gene description: chemokine (C motif) receptor 1, Alternative Gene Names: CCXCR1, GPR5, Validated applications: IHC, Uniprot ID: P46094, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name XCR1
Gene Description chemokine (C motif) receptor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MESSGNPESTTFFYYDLQSQPCENQAWVFATLA
Immunogen MESSGNPESTTFFYYDLQSQPCENQAWVFATLA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CCXCR1, GPR5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P46094
HTS Code 3002150000
Gene ID 2829
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-XCR1 Antibody 100ul

Anti-XCR1 Antibody 100ul