C17orf80,FLJ20721
  • C17orf80,FLJ20721

Anti-C17orf80 Antibody 100ul

Ref: AN-HPA012896-100ul
Anti-C17orf80

Información del producto

Polyclonal Antibody against Human C17orf80, Gene description: chromosome 17 open reading frame 80, Alternative Gene Names: FLJ20721, HLC-8, MIG3, SPEP1, Validated applications: ICC, IHC, WB, Uniprot ID: Q9BSJ5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C17orf80
Gene Description chromosome 17 open reading frame 80
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence AGASLLVGSIEPSLSNQDRKYSSTLPNDVQTTSGDLKLDKIDPQRQELLVKLLDVPTGDCHISPKNVSDGVKRVRTLLSNERDSKGRDHLSGVPTDVTVTETPEKNTESLILSLKMSSLGKIQVM
Immunogen AGASLLVGSIEPSLSNQDRKYSSTLPNDVQTTSGDLKLDKIDPQRQELLVKLLDVPTGDCHISPKNVSDGVKRVRTLLSNERDSKGRDHLSGVPTDVTVTETPEKNTESLILSLKMSSLGKIQVM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20721, HLC-8, MIG3, SPEP1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BSJ5
HTS Code 3002150000
Gene ID 55028
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C17orf80 Antibody 100ul

Anti-C17orf80 Antibody 100ul