SYT7,IPCA-7
  • SYT7,IPCA-7

Anti-SYT7 Antibody 100ul

Ref: AN-HPA012869-100ul
Anti-SYT7

Información del producto

Polyclonal Antibody against Human SYT7, Gene description: synaptotagmin VII, Alternative Gene Names: IPCA-7, MGC150517, PCANAP7, SYT-VII, Validated applications: IHC, WB, Uniprot ID: O43581, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SYT7
Gene Description synaptotagmin VII
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence NSLETVGTPDSGRGRSEKKAIKLPAGGKAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLLP
Immunogen NSLETVGTPDSGRGRSEKKAIKLPAGGKAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLLP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IPCA-7, MGC150517, PCANAP7, SYT-VII
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43581
HTS Code 3002150000
Gene ID 9066
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SYT7 Antibody 100ul

Anti-SYT7 Antibody 100ul