C1GALT1,C1GALT
  • C1GALT1,C1GALT

Anti-C1GALT1 Antibody 25ul

Ref: AN-HPA012819-25ul
Anti-C1GALT1

Información del producto

Polyclonal Antibody against Human C1GALT1, Gene description: core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1, Alternative Gene Names: C1GALT, T-synthase, Validated applications: ICC, IHC, Uniprot ID: Q9NS00, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C1GALT1
Gene Description core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence SKYDPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTDKCTHSSSIEDLALGRCMEIMNVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDS
Immunogen SKYDPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTDKCTHSSSIEDLALGRCMEIMNVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1GALT, T-synthase
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NS00
HTS Code 3002150000
Gene ID 56913
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C1GALT1 Antibody 25ul

Anti-C1GALT1 Antibody 25ul