CADM4,IGSF4C,Necl-4
  • CADM4,IGSF4C,Necl-4

Anti-CADM4 Antibody 25ul

Ref: AN-HPA012612-25ul
Anti-CADM4

Información del producto

Polyclonal Antibody against Human CADM4, Gene description: cell adhesion molecule 4, Alternative Gene Names: IGSF4C, Necl-4, SynCAM4, TSLL2, Validated applications: ICC, IHC, Uniprot ID: Q8NFZ8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CADM4
Gene Description cell adhesion molecule 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence GGIIICEAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDTLVLTCAVTGNPRPNQIRWNRGNESLPERAEAVGETLTLPGLVSADNGTYTCEASNKHGHARALYVLVVYDPGAVVEAQTSVPY
Immunogen GGIIICEAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDTLVLTCAVTGNPRPNQIRWNRGNESLPERAEAVGETLTLPGLVSADNGTYTCEASNKHGHARALYVLVVYDPGAVVEAQTSVPY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IGSF4C, Necl-4, SynCAM4, TSLL2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NFZ8
HTS Code 3002150000
Gene ID 199731
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CADM4 Antibody 25ul

Anti-CADM4 Antibody 25ul