FABP6,I-15P,I-BABP
  • FABP6,I-15P,I-BABP

Anti-FABP6 Antibody 100ul

Ref: AN-HPA012601-100ul
Anti-FABP6

Información del producto

Polyclonal Antibody against Human FABP6, Gene description: fatty acid binding protein 6, ileal, Alternative Gene Names: I-15P, I-BABP, I-BALB, I-BAP, ILBP, ILBP3, ILLBP, Validated applications: IHC, Uniprot ID: P51161, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FABP6
Gene Description fatty acid binding protein 6, ileal
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence AFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKMFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
Immunogen AFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKMFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names I-15P, I-BABP, I-BALB, I-BAP, ILBP, ILBP3, ILLBP
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P51161
HTS Code 3002150000
Gene ID 2172
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FABP6 Antibody 100ul

Anti-FABP6 Antibody 100ul