PVR,CD155,HVED
  • PVR,CD155,HVED

Anti-PVR Antibody 25ul

Ref: AN-HPA012568-25ul
Anti-PVR

Información del producto

Polyclonal Antibody against Human PVR, Gene description: poliovirus receptor, Alternative Gene Names: CD155, HVED, Necl-5, NECL5, PVS, Tage4, Validated applications: IHC, WB, Uniprot ID: P15151, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PVR
Gene Description poliovirus receptor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence DVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFP
Immunogen DVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD155, HVED, Necl-5, NECL5, PVS, Tage4
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P15151
HTS Code 3002150000
Gene ID 5817
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PVR Antibody 25ul

Anti-PVR Antibody 25ul