PSME3,Ki,PA28-gamma
  • PSME3,Ki,PA28-gamma

Anti-PSME3 Antibody 100ul

Ref: AN-HPA012510-100ul
Anti-PSME3

Información del producto

Polyclonal Antibody against Human PSME3, Gene description: proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki), Alternative Gene Names: Ki, PA28-gamma, PA28G, REG-GAMMA, Validated applications: ICC, IHC, WB, Uniprot ID: P61289, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PSME3
Gene Description proteasome (prosome, macropain) activator subunit 3 (PA28 gamma
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence QEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNT
Immunogen QEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Ki, PA28-gamma, PA28G, REG-GAMMA
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P61289
HTS Code 3002150000
Gene ID 10197
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PSME3 Antibody 100ul

Anti-PSME3 Antibody 100ul