CSF1R,C-FMS,CD115
  • CSF1R,C-FMS,CD115

Anti-CSF1R Antibody 25ul

Ref: AN-HPA012323-25ul
Anti-CSF1R

Información del producto

Polyclonal Antibody against Human CSF1R, Gene description: colony stimulating factor 1 receptor, Alternative Gene Names: C-FMS, CD115, CSFR, FMS, Validated applications: ICC, IHC, WB, Uniprot ID: P07333, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CSF1R
Gene Description colony stimulating factor 1 receptor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence NFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQP
Immunogen NFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C-FMS, CD115, CSFR, FMS
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P07333
HTS Code 3002150000
Gene ID 1436
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CSF1R Antibody 25ul

Anti-CSF1R Antibody 25ul