HLA-DQA1,CELIAC1
  • HLA-DQA1,CELIAC1

Anti-HLA-DQA1 Antibody 25ul

Ref: AN-HPA012315-25ul
Anti-HLA-DQA1

Información del producto

Polyclonal Antibody against Human HLA-DQA1, Gene description: major histocompatibility complex, class II, DQ alpha 1, Alternative Gene Names: CELIAC1, HLA-DQA, Validated applications: IHC, WB, Uniprot ID: P01909, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HLA-DQA1
Gene Description major histocompatibility complex, class II, DQ alpha 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence DHVASCGVNLYQFYGPSGQYTHEFDGDEQFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATNEVPEVTVFSKSPVTLGQPNTLI
Immunogen DHVASCGVNLYQFYGPSGQYTHEFDGDEQFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATNEVPEVTVFSKSPVTLGQPNTLI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CELIAC1, HLA-DQA
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P01909
HTS Code 3002150000
Gene ID 3117
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HLA-DQA1 Antibody 25ul

Anti-HLA-DQA1 Antibody 25ul