TNIK,KIAA0551
  • TNIK,KIAA0551

Anti-TNIK Antibody 100ul

Ref: AN-HPA012128-100ul
Anti-TNIK

Información del producto

Polyclonal Antibody against Human TNIK, Gene description: TRAF2 and NCK interacting kinase, Alternative Gene Names: KIAA0551, Validated applications: ICC, IHC, Uniprot ID: Q9UKE5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TNIK
Gene Description TRAF2 and NCK interacting kinase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence QGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSS
Immunogen QGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0551
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UKE5
HTS Code 3002150000
Gene ID 23043
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TNIK Antibody 100ul

Anti-TNIK Antibody 100ul