PHYHD1,MGC16638
  • PHYHD1,MGC16638

Anti-PHYHD1 Antibody 100ul

Ref: AN-HPA012115-100ul
Anti-PHYHD1

Información del producto

Polyclonal Antibody against Human PHYHD1, Gene description: phytanoyl-CoA dioxygenase domain containing 1, Alternative Gene Names: MGC16638, Validated applications: ICC, WB, Uniprot ID: Q5SRE7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PHYHD1
Gene Description phytanoyl-CoA dioxygenase domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence VLEGFLSAEECVAMQQRIGEIVAEMDVPLHCRTEFSTQEEEQLRAQGSTDYFLSSGDKIRFFFEKGVFDEKGNFLVPPEKSINKIGHALHAHDPVFKSITHSFKVQTLARSLGLQMPVVV
Immunogen VLEGFLSAEECVAMQQRIGEIVAEMDVPLHCRTEFSTQEEEQLRAQGSTDYFLSSGDKIRFFFEKGVFDEKGNFLVPPEKSINKIGHALHAHDPVFKSITHSFKVQTLARSLGLQMPVVV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC16638
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5SRE7
HTS Code 3002150000
Gene ID 254295
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PHYHD1 Antibody 100ul

Anti-PHYHD1 Antibody 100ul