CHD4,Mi-2b,Mi2-BETA
  • CHD4,Mi-2b,Mi2-BETA

Anti-CHD4 Antibody 25ul

Ref: AN-HPA012008-25ul
Anti-CHD4

Información del producto

Polyclonal Antibody against Human CHD4, Gene description: chromodomain helicase DNA binding protein 4, Alternative Gene Names: Mi-2b, Mi2-BETA, Validated applications: ICC, IHC, Uniprot ID: Q14839, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CHD4
Gene Description chromodomain helicase DNA binding protein 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence DALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKPRDPKIPKSKRQKKELGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEDDDDDDSKEP
Immunogen DALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKPRDPKIPKSKRQKKELGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEDDDDDDSKEP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Mi-2b, Mi2-BETA
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14839
HTS Code 3002150000
Gene ID 1108
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CHD4 Antibody 25ul

Anti-CHD4 Antibody 25ul