TSPAN1,NET-1,TSPAN-1
  • TSPAN1,NET-1,TSPAN-1

Anti-TSPAN1 Antibody 25ul

Ref: AN-HPA011909-25ul
Anti-TSPAN1

Información del producto

Polyclonal Antibody against Human TSPAN1, Gene description: tetraspanin 1, Alternative Gene Names: NET-1, TSPAN-1, Validated applications: ICC, IHC, WB, Uniprot ID: O60635, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TSPAN1
Gene Description tetraspanin 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence TMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTNAVTV
Immunogen TMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTNAVTV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NET-1, TSPAN-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60635
HTS Code 3002150000
Gene ID 10103
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TSPAN1 Antibody 25ul

Anti-TSPAN1 Antibody 25ul