NPRL3,C16orf35
  • NPRL3,C16orf35

Anti-NPRL3 Antibody 100ul

Ref: AN-HPA011741-100ul
Anti-NPRL3

Información del producto

Polyclonal Antibody against Human NPRL3, Gene description: nitrogen permease regulator-like 3 (S. cerevisiae), Alternative Gene Names: C16orf35, CGTHBA, HS-40, MARE, NPR3, RMD11, Validated applications: ICC, IHC, Uniprot ID: Q12980, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NPRL3
Gene Description nitrogen permease regulator-like 3 (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence GDSRFSDVILATILATKSEMCGQKFELKIDNVRFVGHPTLLQHALGQISKTDPSPKREAPTMILFNVVFALRANADPSVINCLHNLSRRIATVLQHEERRCQYLTREAKLILALQDEVSAMADGNEGPQSPFHHILPKCK
Immunogen GDSRFSDVILATILATKSEMCGQKFELKIDNVRFVGHPTLLQHALGQISKTDPSPKREAPTMILFNVVFALRANADPSVINCLHNLSRRIATVLQHEERRCQYLTREAKLILALQDEVSAMADGNEGPQSPFHHILPKCK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C16orf35, CGTHBA, HS-40, MARE, NPR3, RMD11
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q12980
HTS Code 3002150000
Gene ID 8131
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NPRL3 Antibody 100ul

Anti-NPRL3 Antibody 100ul