HDAC2,RPD3,YAF1
  • HDAC2,RPD3,YAF1

Anti-HDAC2 Antibody 25ul

Ref: AN-HPA011727-25ul
Anti-HDAC2

Información del producto

Polyclonal Antibody against Human HDAC2, Gene description: histone deacetylase 2, Alternative Gene Names: RPD3, YAF1, Validated applications: ICC, IHC, WB, Uniprot ID: Q92769, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HDAC2
Gene Description histone deacetylase 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications WB, IHC, ICC
Sequence IACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP
Immunogen IACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names RPD3, YAF1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92769
HTS Code 3002150000
Gene ID 3066
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HDAC2 Antibody 25ul

Anti-HDAC2 Antibody 25ul